PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSMUA_Achr5P04420_001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Zingiberales; Musaceae; Musa
Family TALE
Protein Properties Length: 251aa    MW: 28688.4 Da    PI: 6.1574
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSMUA_Achr5P04420_001genomeCIRADView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox23.21.2e-071571892254
                            SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
               Homeobox  22 nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                             +yp+++++++L +++gL+ +q+ +WF N+R +
  GSMUA_Achr5P04420_001 157 WPYPTEDDKARLVQQTGLQLKQINNWFINQRKR 189
                            59*****************************87 PP

2ELK27.85.8e-10110131122
                    ELK   1 ELKhqLlrKYsgyLgsLkqEFs 22 
                            ELKh+L+++Y+++L+++++E++
  GSMUA_Achr5P04420_001 110 ELKHELKQGYKEKLMDIREEIL 131
                            9*******************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM012561.7E-101055IPR005541KNOX2
PfamPF037911.4E-101654IPR005541KNOX2
PROSITE profilePS5121310.092110130IPR005539ELK domain
SMARTSM011880.0012110131IPR005539ELK domain
PfamPF037893.8E-6110131IPR005539ELK domain
PROSITE profilePS5007111.596130193IPR001356Homeobox domain
SMARTSM003899.1E-10132197IPR001356Homeobox domain
SuperFamilySSF466898.13E-16132195IPR009057Homeodomain-like
CDDcd000866.28E-10133194No hitNo description
Gene3DG3DSA:1.10.10.604.9E-25137194IPR009057Homeodomain-like
PfamPF059201.7E-17150189IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 251 aa     Download sequence    Send to blast
MLELQLILNV FSNQANYVLL LCSFKEQLQQ HVRVHAMDAV MACWELEQNL QSLTGVSPGE  60
GTGATMSDDE EDEADGDVTL FDASLDGTED MGFGLPTERE RSLMERVRQE LKHELKQGYK  120
EKLMDIREEI LRKRRAGKLP GDTTTLLKAW WQSHSKWPYP TEDDKARLVQ QTGLQLKQIN  180
NWFINQRKRN WQSNPSPSTS LKSKRKRCVS IYSQSKAEEL LPPWSKTALA MQDIVGGENR  240
TQFASTAVKS D
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1x2n_A3e-14133196871Homeobox protein PKNOX1
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1186206RKRNWQSNPSPSTSLKSKRKR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015650702.11e-123PREDICTED: homeobox protein knotted-1-like 13 isoform X3
RefseqXP_015650701.11e-123PREDICTED: homeobox protein knotted-1-like 13 isoform X2
SwissprotQ0J6N41e-123KNOSD_ORYSJ; Homeobox protein knotted-1-like 13
TrEMBLM0SVM10.0M0SVM1_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr5P04420_0010.0(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP56438169
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G25220.21e-116KNOTTED1-like homeobox gene 3